Aeromonas hydrophila YL17: AI20_09615 Help Entry AI20_09615        CDS       T03186                                  Name (GenBank) damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism ahd  Aeromonas hydrophila YL17 Brite KEGG Orthology (KO) [BR:ahd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ahd03400]     AI20_09615 DNA repair and recombination proteins [BR:ahd03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     AI20_09615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI DUF7320 Motif Other DBs NCBI-ProteinID:  AHV35432 LinkDB All DBs Position 3208419..3208667 Genome browser AA seq 82 aa AA seqDB search MRLEIIIDKKHQVPTSTMEALRQELLKQLGEKFPDLHVRVAPGSAMALTVSRASKEEKEL AEAMVQEVWENADSWMPESAAS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgtctggaaatcatcatcgacaagaaacatcaggtgcccacctcaaccatggaggcg ctgcgccaggagctgctcaagcagctgggcgagaagttccccgacctgcatgttcgcgtc gcccccggcagtgccatggcgttgaccgtcagccgggccagcaaggaggagaaggagctg gcggaagccatggtgcaggaggtgtgggagaacgccgacagctggatgccggagagtgca gcctcctga

DBGET integrated database retrieval system