Aeromonas hydrophila YL17: AI20_14950 Help Entry AI20_14950        CDS       T03186                                  Symbol groES Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism ahd  Aeromonas hydrophila YL17 Brite KEGG Orthology (KO) [BR:ahd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ahd03110]     AI20_14950 (groES)    03029 Mitochondrial biogenesis [BR:ahd03029]     AI20_14950 (groES) Chaperones and folding catalysts [BR:ahd03110]  Heat shock proteins   HSP10    AI20_14950 (groES) Mitochondrial biogenesis [BR:ahd03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     AI20_14950 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Rad9_Rad53_bind Motif Other DBs NCBI-ProteinID:  AHV36431 LinkDB All DBs Position 2043354..2043647 Genome browser AA seq 97 aa AA seqDB search MKIRPLHDRVIIKRIEAEAKSAGGIVLTGTAAQKSTRGEVLAVGTGRILDNGDVKALAVK VGDKVIFNEGYGVKTEKLDGQDVLILSETDILAIVEE NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtccactgcacgaccgcgtcatcatcaagcgcatcgaagctgaagccaaa tccgctggcggcattgtcttgactggtacggcggcccagaagtccacccgtggtgaagtt cttgccgtggggactggccgaattctggataatggcgacgtcaaagccctcgccgtcaag gttggtgacaaggtgatcttcaacgaaggctacggtgtgaagaccgagaagctggatggt caggacgtgctgatcctgtctgaaaccgacatcctggcgattgtcgaagagtaa

DBGET integrated database retrieval system