Aeromonas hydrophila YL17: AI20_18535 Help Entry AI20_18535        CDS       T03186                                  Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism ahd  Aeromonas hydrophila YL17 Brite KEGG Orthology (KO) [BR:ahd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ahd03036]     AI20_18535 Chromosome and associated proteins [BR:ahd03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AI20_18535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA DUF7491 DUF2046 NET2A HR1 TSC22 Nuf2_DHR10-like TolA_bind_tri ADIP XRCC4_CC Uso1_p115_C DUF7603 NUDE_C DivIC K-box Mod_r ACBP4_C DUF6262 Spectrin GAS CCDC138_cc Herpes_UL6 bZIP_1 CtIP_N DUF2203 FliT Spc24 FlaC_arch bZIP_2 DUF244 Cep57_MT_bd Prominin Motif Other DBs NCBI-ProteinID:  AHV37098 LinkDB All DBs Position 1305758..1305967 Genome browser AA seq 69 aa AA seqDB search MSLEVLEQLESKVQSAVDNISLLKMELDELKEQNSKLQDENHQLRNEHVAWQERLRALLG KMDQMGESI NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgtcactagaagtccttgagcaactcgaatccaaagtacaatccgccgtcgacaacatc tccctgctgaagatggagctggacgagctgaaagagcagaacagcaagctgcaagacgag aaccatcagctgcgcaacgagcacgttgcctggcaagagcgtctgcgtgccctgttgggc aagatggatcagatgggcgaaagcatctaa

DBGET integrated database retrieval system