Aeromonas hydrophila YL17: AI20_19265 Help Entry AI20_19265        CDS       T03186                                  Name (GenBank) ATP F0F1 synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism ahd  Aeromonas hydrophila YL17 Pathway ahd00190   Oxidative phosphorylation ahd01100   Metabolic pathways Module ahd_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ahd00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AI20_19265  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ahd00194]     AI20_19265 Photosynthesis proteins [BR:ahd00194]  Photosystem and electron transport system   F-type ATPase [OT]    AI20_19265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AHV37231 LinkDB All DBs Position 1159590..1159832 Genome browser AA seq 80 aa AA seqDB search MENLNMDLLYIAAAMMMGLAAIGASIGIGILGGKFLEGAARQPDLIPVLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVAG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaaaacttgaacatggacctgctgtacatcgctgctgcaatgatgatgggtctggcg gctatcggcgcttccatcggtatcggtatcctgggtggcaaattcctggaaggtgcagct cgtcaaccggacctgatccctgttctgcgtacccagttcttcatcgtgatgggtctggtg gatgcgatcccgatgatcgccgttggtctgggtctgtacgtgatgtttgcggttgccggc taa

DBGET integrated database retrieval system