Aureliella helgolandensis: Q31a_24710 Help Entry Q31a_24710        CDS       T06948                                  Name (GenBank) sec-independent translocase   KO K03116   sec-independent protein translocase protein TatA Organism ahel  Aureliella helgolandensis Pathway ahel03060   Protein export ahel03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:ahel00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Q31a_24710  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     Q31a_24710  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ahel02044]     Q31a_24710 Secretion system [BR:ahel02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    Q31a_24710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E EHN UB2H Motif Other DBs NCBI-ProteinID:  QDV24158 UniProt:  A0A518G6D9 LinkDB All DBs Position complement(3158256..3158525) Genome browser AA seq 89 aa AA seqDB search MFNGLGTTEMVLFGIIALMLFGSRLPEVARSFGGTYRELRKKVDDFQREFRDWDRAEPTI NRLPAPKDSGEVDSGEPQSPKFVPPADDD NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgttcaacggcttaggcaccacagaaatggtcctgtttgggatcattgcgctgatgcta ttcggtagccgccttccggaagttgcccgcagcttcggagggacctatcgcgaattgcgc aagaaagtggatgatttccaacgcgaatttcgtgattgggaccgcgcagaaccgaccatc aatcgccttccggcccctaaagactcaggcgaagtcgattcgggcgaaccccaatctcct aaattcgtcccacccgctgacgacgactag

DBGET integrated database retrieval system