Aureliella helgolandensis: Q31a_36850 Help Entry Q31a_36850        CDS       T06948                                  Symbol acpP_4 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ahel  Aureliella helgolandensis Pathway ahel00998   Biosynthesis of various antibiotics ahel01100   Metabolic pathways ahel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Q31a_36850 (acpP_4)    00074 Mycolic acid biosynthesis     Q31a_36850 (acpP_4)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Q31a_36850 (acpP_4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDV25359 UniProt:  A0A518G9W4 LinkDB All DBs Position complement(4810865..4811116) Genome browser AA seq 83 aa AA seqDB search MSPAEIRDEIIDILSEIAPDEDLSNLNDEQSFREQMELDSMDFLDIVMELRKRHRIQIPE DQYGELASMASTVKYLEPKMADI NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagtccagcggagattcgagacgaaatcatcgacattctcagcgagattgctcccgat gaagatctgagcaaccttaatgatgagcaatcgtttcgcgagcaaatggagctcgattcg atggacttcttggacatcgtgatggaactgcgcaagcggcatcgcattcagattcctgag gatcagtatggcgaattggcgagcatggcgagcacggtgaagtaccttgaacccaaaatg gctgacatctag

DBGET integrated database retrieval system