KEGG   Aureliella helgolandensis: Q31a_45470
Entry
Q31a_45470        CDS       T06948                                 
Symbol
ravA_4
Name
(GenBank) ATPase RavA
  KO
K03924  MoxR-like ATPase [EC:3.6.3.-]
Organism
ahel  Aureliella helgolandensis
Brite
KEGG Orthology (KO) [BR:ahel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Q31a_45470 (ravA_4)
SSDB
Motif
Pfam: AAA_3 AAA_lid_2 bpMoxR AAA_5 AAA Sigma54_activat AAA_2 RuvB_N MCM Mg_chelatase TIP49
Other DBs
NCBI-ProteinID: QDV26175
UniProt: A0A518GC57
LinkDB
Position
complement(5886864..5887808)
AA seq 314 aa
MTEVSGELDLTRLRANVESAVLGKPEVVKLVVTALLAGEHILLEDVPGVGKTLIAKAVAR
SVDGHFSRLQFTPDLLPSDITGSSIYNSSSGQFTFNRGPIFANVVLADEINRAPPRTQSA
LLEAMGEGQVSVDGETHALPDPLLVIATQNPFEFEGTYLLPESQLDRFLLRITVGYPDRD
YELQLLHSHRVGEPVDELKPAVSLDQVRALQRQVREVNFEESLVRYLLDIVHATRDSEAV
QVGVSTRGALAYYRAAQAIATVENRSHVIPDDIKRLAIPVMAHRIVPRGMLPGADRSASE
ELVRRLLGQIRVPT
NT seq 945 nt   +upstreamnt  +downstreamnt
atgactgaggtgagtggcgaactggacctaacgcggcttagggcgaatgttgagtccgct
gttttggggaaacccgaagtggttaagcttgtcgtaactgccctgcttgctggcgagcat
attctgctggaagatgtgccaggagttggaaagacgctgattgccaaggcggtggcgcgg
agcgtggatggtcatttttcacggctccaatttacgcccgacttgttgcccagtgatatt
accggtagcagtatctacaattcatcgagtgggcagtttaccttcaatcgagggcccatt
ttcgcaaatgtggtcttggctgatgaaatcaatcgcgcaccgccgcgaacgcaaagcgca
ctgttagaggccatgggggagggacaagtcagcgtcgatggtgagacgcatgcgttgccc
gatcccttgttggtgatcgctactcagaacccatttgaattcgaaggcacgtacttgctg
ccagaaagtcagctggatcggtttctgttgcgaatcacggtgggctatcccgaccgtgac
tatgaattgcagttgttgcactcgcatcgggttggtgagccggtggacgagcttaaaccg
gcggtctcgttggaccaggttcgcgccttgcaaaggcaggttcgcgaagtcaactttgag
gaatccctcgttcgctatctgctcgatatcgtccatgccactcgggacagcgaggctgtt
caggtaggagtcagcacgcgtggtgcactggcttattatcgggccgctcaagccattgca
acggttgaaaatcgatcccatgtcattccagacgacatcaagcgattggcaatcccagtc
atggcccaccgcattgtgcccagaggcatgttaccgggagcggaccgctcagcctctgag
gagttggtccgccggctacttgggcaaattcgcgttccgacttag

DBGET integrated database retrieval system