Arachis hypogaea (peanut): 112696148 Help Entry 112696148         CDS       T07294                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism ahf  Arachis hypogaea (peanut) Pathway ahf03083   Polycomb repressive complex ahf04120   Ubiquitin mediated proteolysis ahf04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ahf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112696148    04120 Ubiquitin mediated proteolysis     112696148   09126 Chromosome    03083 Polycomb repressive complex     112696148  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ahf04131]     112696148    04121 Ubiquitin system [BR:ahf04121]     112696148    03036 Chromosome and associated proteins [BR:ahf03036]     112696148 Membrane trafficking [BR:ahf04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     112696148 Ubiquitin system [BR:ahf04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      112696148    Cul7 complex      112696148 Chromosome and associated proteins [BR:ahf03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      112696148   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      112696148 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB DarP Motif Other DBs NCBI-GeneID:  112696148 NCBI-ProteinID:  XP_025604546 LinkDB All DBs Position 6:13614235..13614705 Genome browser AA seq 156 aa AA seqDB search MGSPLKKIMLCSSEKEIFSVEEQVMVQHSVIINNMIEDGLYNHEESKIPLDCVDSKTLKK VIDYCTHQTHHHNDNQEDLEAWEAQFFNVDSNGLYDLLMAANYLEIRNLLNLIYGTIKNM IKGKKIDEIRRIFNIKDHGFTPEEEEQNRKEYPHFY NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgggctcgccgttgaagaagatcatgctatgcagttcggaaaaggagattttcagtgtg gaagaacaagtgatggtgcaacattcggtgatcataaacaacatgatagaagatgggttg tacaaccatgaagagagcaagattccattggattgcgttgactccaagactctcaagaag gtcatcgattattgtacacaccaaactcaccaccacaacgacaatcaagaagatcttgag gcttgggaagctcaatttttcaatgttgattctaacggcctttatgatttgttgatggca gcaaattatctcgagattagaaatctcttgaatctgatatacggaactataaaaaatatg ataaagggaaagaaaatagatgagatacgcagaatcttcaacatcaaagatcatggcttc actcctgaagaggaagaacaaaatcgcaaggaatacccacatttttattag

DBGET integrated database retrieval system