Arachis hypogaea (peanut): 112696179 Help Entry 112696179         CDS       T07294                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism ahf  Arachis hypogaea (peanut) Pathway ahf03018   RNA degradation ahf03040   Spliceosome Brite KEGG Orthology (KO) [BR:ahf00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     112696179   09123 Folding, sorting and degradation    03018 RNA degradation     112696179  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ahf03019]     112696179    03041 Spliceosome [BR:ahf03041]     112696179 Messenger RNA biogenesis [BR:ahf03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      112696179   mRNA degradation factors    5'-3' decay     Lsm complex      112696179 Spliceosome [BR:ahf03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     112696179  Complex C   U2 snRNP components     112696179 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DUF150_C Motif Other DBs NCBI-GeneID:  112696179 NCBI-ProteinID:  XP_025604586 LinkDB All DBs Position 6:14227359..14230236 Genome browser AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPEGVDVELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgttcttctcgtacttcaaggatttggtgggaagagaagtaacggtggagctcaag aacgatttggccataaggggcactcttcactccgttgaccagtacctcaacatcaagctc gagaacactcgcgtcgttgaccaagacaagtacccccatatgctttctgtgaggaactgc ttcatcagaggttcagtggtcagatacgtgcaattacctccagaaggcgtggacgttgaa ctattgcacgatgccactaggagagaagctcggggtggttaa

DBGET integrated database retrieval system