Arachis hypogaea (peanut): 112703766 Help Entry 112703766         CDS       T07294                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism ahf  Arachis hypogaea (peanut) Brite KEGG Orthology (KO) [BR:ahf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:ahf03041]     112703766   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ahf04052]     112703766 Spliceosome [BR:ahf03041]  Complex B   Other components    Complex B specific factors     112703766 Cytokines and neuropeptides [BR:ahf04052]  Neuropeptides   Unclassified    112703766 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Ubiquitin_4 Motif Other DBs NCBI-GeneID:  112703766 NCBI-ProteinID:  XP_025611431 LinkDB All DBs Position 1:complement(8188218..8188546) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYTIYKDHITLKDC EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggttctaaacgatcgattggggaagaaggttcgcgtgaaatgcaacgat gacgacaccatcggagacctgaagaagctggttgcagctcagacaggaacgagggccgac aagattcgcatccagaagtggtacaccatctacaaggatcatatcaccctcaaagattgc gagatccacgacggcatgggcctcgagctctactacaactaa

DBGET integrated database retrieval system