Arachis hypogaea (peanut): 112706776 Help Entry 112706776         CDS       T07294                                  Name (RefSeq) uncharacterized protein   KO K09481   protein transport protein SEC61 subunit beta Organism ahf  Arachis hypogaea (peanut) Pathway ahf03060   Protein export ahf04141   Protein processing in endoplasmic reticulum ahf04145   Phagosome Brite KEGG Orthology (KO) [BR:ahf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     112706776    04141 Protein processing in endoplasmic reticulum     112706776  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112706776  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ahf04131]     112706776   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ahf02044]     112706776 Membrane trafficking [BR:ahf04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     112706776 Secretion system [BR:ahf02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    112706776 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta PRR18 Motif Other DBs NCBI-GeneID:  112706776 NCBI-ProteinID:  XP_025614027 LinkDB All DBs Position 8:28450818..28451676 Genome browser AA seq 108 aa AA seqDB search MARGASQSQSATSATTTRPGVMAPRGSAAATAGMRRRRLAGGSTGGNSSGSVGGGGGPTN MLRFYTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRYKAGANA NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcaagaggcgcctctcaatctcagtcggcaacatctgccaccaccactcgcccggga gtcatggctccccgcggctccgctgccgccactgccggcatgcgtcgccgtcgcctagct ggaggcagcacaggcggaaacagctccggcagcgttggaggcggtggagggcctaccaac atgctccggttctacacggacgacgcgccaggactgaagatatcgccgacggtggtgctg gtgatgagcctctgcttcatcggcttcgtcaccgccctacatgtcttcggcaagctgtac cgctacaaagctggcgccaacgcttga

DBGET integrated database retrieval system