Arachis hypogaea (peanut): 112708431 Help Entry 112708431         CDS       T07294                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism ahf  Arachis hypogaea (peanut) Pathway ahf04145   Phagocytosis ahf04517   IgSF CAM signaling ahf04814   Motor proteins Brite KEGG Orthology (KO) [BR:ahf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112708431  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     112708431   09142 Cell motility    04814 Motor proteins     112708431  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ahf03037]     112708431    04812 Cytoskeleton proteins [BR:ahf04812]     112708431 Cilium and associated proteins [BR:ahf03037]  Motile cilia and associated proteins   Dynein arm    112708431 Cytoskeleton proteins [BR:ahf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      112708431 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Orcokinin RIC1 Motif Other DBs NCBI-GeneID:  112708431 NCBI-ProteinID:  XP_025616372 LinkDB All DBs Position 8 Genome browser AA seq 109 aa AA seqDB search MLEGKAVIGETDMLKTMQQDALDLASKALDSFDVTDAIEIARFIKKEFDKSHGTGWQCIV GTDFGSYVTHCYGCFIYFGIGNLAILLFRGSAGPEAQENHFSAIEAAKP NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgttagaaggcaaggcagtgattggtgagaccgacatgcttaaaaccatgcagcaagat gcacttgatttagcatcaaaggcacttgattcctttgatgtcactgacgccattgagatt gctcgctttatcaagaaggaatttgacaagagtcatggaactggatggcaatgcattgta ggaacagattttggttcatatgtgacacattgttatggatgtttcatctattttggaatt ggaaatttggccattttgctctttaggggctctgctggtcctgaggcacaggaaaatcac ttctcagcaatagaggcagcaaaaccataa

DBGET integrated database retrieval system