Arachis hypogaea (peanut): 112710418 Help Entry 112710418         CDS       T07294                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism ahf  Arachis hypogaea (peanut) Pathway ahf04136   Autophagy - other Brite KEGG Orthology (KO) [BR:ahf00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     112710418  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ahf04131]     112710418    04121 Ubiquitin system [BR:ahf04121]     112710418    03029 Mitochondrial biogenesis [BR:ahf03029]     112710418 Membrane trafficking [BR:ahf04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     112710418 Ubiquitin system [BR:ahf04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    112710418 Mitochondrial biogenesis [BR:ahf03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     112710418 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  112710418 NCBI-ProteinID:  XP_025618402 LinkDB All DBs Position 9:complement(12563008..12566660) Genome browser AA seq 94 aa AA seqDB search MAAESPSSVRKVVVHLRATGDAPILKQSKFKIAGADKFAKVIDFLRRQLHRETLFVYVNS AFSPNPDESIIDLYTNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctgctgagtcaccaagttccgttcgtaaagtggttgttcatctgagagccactggt gatgctcctattctcaagcaatctaaattcaagatagcaggagctgataaatttgcaaag gtgatagattttcttagacggcaactccacagggaaacattgtttgtatatgtaaacagt gctttttcacccaatcctgatgaatcgatcattgatttgtatactaattttggttttgat ggcaaattggtggtcaactacgcatgttctatggcatggggctaa

DBGET integrated database retrieval system