Arachis hypogaea (peanut): 112723094 Help Entry 112723094         CDS       T07294                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism ahf  Arachis hypogaea (peanut) Pathway ahf04145   Phagocytosis ahf04517   IgSF CAM signaling ahf04814   Motor proteins Brite KEGG Orthology (KO) [BR:ahf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112723094  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     112723094   09142 Cell motility    04814 Motor proteins     112723094  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ahf03037]     112723094    04812 Cytoskeleton proteins [BR:ahf04812]     112723094 Cilium and associated proteins [BR:ahf03037]  Motile cilia and associated proteins   Dynein arm    112723094 Cytoskeleton proteins [BR:ahf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      112723094 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light MesX Motif Other DBs NCBI-GeneID:  112723094 NCBI-ProteinID:  XP_025630121 LinkDB All DBs Position 11 Genome browser AA seq 124 aa AA seqDB search MSGEDTRKSIGGGTLMARPNSDEHAPKPSSATATPPPTKKIIIKSADMPPDLQREAVDIA VSAFEKCNVEKDVAEHIKKVFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLL FKSG NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgagcggcgaggacaccagaaagagcatcggaggaggaactctgatggcgaggcccaat tccgacgaacatgctccaaagccatcgtcagcaacagcaacgccccctcccaccaagaag atcatcatcaagagtgccgatatgccccccgacttgcaaagggaggccgttgatatcgcc gtctccgcatttgagaagtgcaatgtcgagaaagacgttgcggagcacatcaagaaggtc ttcgacaagaggcatggtcccacttggcattgcatcgttggtcgcaattttggttcttat gtgactcatgaaacaaaccactttgtttatttctatttggatcagaaagcagttctgctt tttaagtctggctag

DBGET integrated database retrieval system