Arachis hypogaea (peanut): 112735882 Help Entry 112735882         CDS       T07294                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism ahf  Arachis hypogaea (peanut) Pathway ahf04145   Phagocytosis ahf04517   IgSF CAM signaling ahf04814   Motor proteins Brite KEGG Orthology (KO) [BR:ahf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112735882  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     112735882   09142 Cell motility    04814 Motor proteins     112735882  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ahf03037]     112735882    04812 Cytoskeleton proteins [BR:ahf04812]     112735882 Cilium and associated proteins [BR:ahf03037]  Motile cilia and associated proteins   Dynein arm    112735882 Cytoskeleton proteins [BR:ahf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      112735882 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  112735882 NCBI-ProteinID:  XP_025641113 LinkDB All DBs Position 13 Genome browser AA seq 101 aa AA seqDB search MLEGKGMVKETDMPLKMQIQAMACASKALDLYDVHDCISIAAHIKKEFDKVYGMGWQCVV GFNFGCFFTHSPGTFIYFALETLNFLIYKGTSSDLSSLSVT NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgttggaagggaaaggtatggtgaaagaaactgacatgccgttgaagatgcaaatccag gccatggcatgtgcttctaaggcccttgacctttatgatgttcatgattgcatctctatt gctgctcacatcaagaaggaatttgataaggtgtatggaatgggatggcaatgtgtggtg ggtttcaattttgggtgcttcttcacccattcacctggcactttcatctattttgctctt gagacccttaatttccttatatacaagggaacctcctctgatctctcttccctttctgta acatag

DBGET integrated database retrieval system