Arachis hypogaea (peanut): 112768998 Help Entry 112768998         CDS       T07294                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism ahf  Arachis hypogaea (peanut) Pathway ahf04517   IgSF CAM signaling ahf04814   Motor proteins Brite KEGG Orthology (KO) [BR:ahf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112768998  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     112768998  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ahf03037]     112768998    04812 Cytoskeleton proteins [BR:ahf04812]     112768998 Cilium and associated proteins [BR:ahf03037]  Motile cilia and associated proteins   Dynein arm    112768998 Cytoskeleton proteins [BR:ahf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      112768998 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  112768998 NCBI-ProteinID:  XP_025669168 LinkDB All DBs Position 18:21217621..21219004 Genome browser AA seq 109 aa AA seqDB search MLEGKAVIGETDMLKTMQQDALDLASKALDSFDVTDAIEIARFIKKEFDKSHGSGWQCIV GTDFGSYVTHCYGCFIYFGIGSLAILLFRGSAGPEAQENHFSALEAAKP NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgttagaaggcaaggcagtgattggtgagaccgacatgcttaaaaccatgcagcaagat gcacttgatttagcatcaaaggcacttgattcctttgatgtcactgacgccattgagatt gctcgctttatcaagaaggaatttgacaagagtcatggaagtgggtggcaatgcattgta ggaacagattttggttcatatgtgacacattgttatggatgtttcatctattttggaatt ggaagtttggccattttgctctttaggggctctgctggtcctgaggcacaggaaaatcac ttctcagcactagaggcagcaaaaccataa

DBGET integrated database retrieval system