Arachis hypogaea (peanut): 112770852
Help
Entry
112770852 CDS
T07294
Name
(RefSeq) mitochondrial import inner membrane translocase subunit TIM17-2
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
ahf
Arachis hypogaea (peanut)
Brite
KEGG Orthology (KO) [BR:
ahf00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
ahf03029
]
112770852
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ahf02000
]
112770852
Mitochondrial biogenesis [BR:
ahf03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
112770852
Transporters [BR:
ahf02000
]
Other transporters
Primary active transporters [TC:
3
]
112770852
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
112770852
NCBI-ProteinID:
XP_025671077
LinkDB
All DBs
Position
18:complement(129766350..129770322)
Genome browser
AA seq
218 aa
AA seq
DB search
MGTPETTREPCPDRILDDIGGAFGMGVFGGSGFHFIKGFFNSPKGSRLVGASQAVRLNAP
RLGGSFAVWGGLFATFDCTLVYVRQKEDPWNSIISGFAAGGFLSLRHGPAVATRSAVFGG
VLLALMEGGMIMLNKTLYAVPPLTEEATLAGYPSGVGFPGQHGPQPSPPTASKSEAKTSW
FGGFFGGGKKEEPAFGRESETKILESFDAPQVPNFEYK
NT seq
657 nt
NT seq
+upstream
nt +downstream
nt
atgggaaccccggagacaacacgcgagccctgccctgatcgcatccttgacgacattggc
ggcgctttcggcatgggagtcttcggaggctccggctttcacttcatcaagggcttcttc
aactctcccaagggttcacgcctcgtcggtgcttcacaggcagttcgtctcaacgcgccg
agactgggcggaagctttgcggtttggggtggactcttcgccaccttcgactgtaccttg
gtctatgttcgtcagaaggaggatccatggaactcaatcatatctggattcgctgccgga
ggatttctctccctgcgtcatggacccgccgtcgccacgcgctccgccgtgttcggtggt
gtcttgctggcccttatggaaggaggtatgatcatgcttaacaagaccttatatgcggta
ccgcctctcacggaggaagctacgctggctggttacccttcaggcgtcggatttccgggt
cagcacggtcctcagccttctccgccgacggcctcgaaatcggaggctaaaacttcttgg
tttggtggattcttcggtggagggaagaaggaggagccggcttttggtagagaaagcgaa
acgaagattctggagagttttgatgccccacaggtgccgaatttcgagtacaagtga
DBGET
integrated database retrieval system