KEGG   Arachis hypogaea (peanut): 112770852
Entry
112770852         CDS       T07294                                 
Name
(RefSeq) mitochondrial import inner membrane translocase subunit TIM17-2
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
ahf  Arachis hypogaea (peanut)
Brite
KEGG Orthology (KO) [BR:ahf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ahf03029]
    112770852
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ahf02000]
    112770852
Mitochondrial biogenesis [BR:ahf03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    112770852
Transporters [BR:ahf02000]
 Other transporters
  Primary active transporters [TC:3]
   112770852
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 112770852
NCBI-ProteinID: XP_025671077
LinkDB
Position
18:complement(129766350..129770322)
AA seq 218 aa
MGTPETTREPCPDRILDDIGGAFGMGVFGGSGFHFIKGFFNSPKGSRLVGASQAVRLNAP
RLGGSFAVWGGLFATFDCTLVYVRQKEDPWNSIISGFAAGGFLSLRHGPAVATRSAVFGG
VLLALMEGGMIMLNKTLYAVPPLTEEATLAGYPSGVGFPGQHGPQPSPPTASKSEAKTSW
FGGFFGGGKKEEPAFGRESETKILESFDAPQVPNFEYK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgggaaccccggagacaacacgcgagccctgccctgatcgcatccttgacgacattggc
ggcgctttcggcatgggagtcttcggaggctccggctttcacttcatcaagggcttcttc
aactctcccaagggttcacgcctcgtcggtgcttcacaggcagttcgtctcaacgcgccg
agactgggcggaagctttgcggtttggggtggactcttcgccaccttcgactgtaccttg
gtctatgttcgtcagaaggaggatccatggaactcaatcatatctggattcgctgccgga
ggatttctctccctgcgtcatggacccgccgtcgccacgcgctccgccgtgttcggtggt
gtcttgctggcccttatggaaggaggtatgatcatgcttaacaagaccttatatgcggta
ccgcctctcacggaggaagctacgctggctggttacccttcaggcgtcggatttccgggt
cagcacggtcctcagccttctccgccgacggcctcgaaatcggaggctaaaacttcttgg
tttggtggattcttcggtggagggaagaaggaggagccggcttttggtagagaaagcgaa
acgaagattctggagagttttgatgccccacaggtgccgaatttcgagtacaagtga

DBGET integrated database retrieval system