Arachis hypogaea (peanut): 112771548 Help Entry 112771548         CDS       T07294                                  Name (RefSeq) protein MHF1 homolog isoform X1   KO K11511   centromere protein S Organism ahf  Arachis hypogaea (peanut) Pathway ahf03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ahf00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     112771548  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ahf03036]     112771548    03400 DNA repair and recombination proteins [BR:ahf03400]     112771548 Chromosome and associated proteins [BR:ahf03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      112771548 DNA repair and recombination proteins [BR:ahf03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      112771548 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Bromo_TP Not1 CBFD_NFYB_HMF F420_oxidored UCH_UBL1 Motif Other DBs NCBI-GeneID:  112771548 NCBI-ProteinID:  XP_025672103 LinkDB All DBs Position 18:complement(133695040..133696738) Genome browser AA seq 135 aa AA seqDB search MAMDRVVCGSSSEIERGEEQEEHDSEARLLRDRFRLSAISIAESEARKSGMEISKVVVSC VADLAFKFTEGLAKDLQIFAQHANRKCVNMEDVILSAHRNEHISSYLRTFSNDLKANASE RKRTKETKKNDKTPI NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggcaatggatcgcgtagtgtgtggtagcagcagcgaaatcgaaagaggagaagaacaa gaagaacatgactccgaagcgaggctcttgcgcgataggttcagactctccgcaatctcc atcgccgaatccgaagcacgtaagagtggcatggaaatatcgaaagtcgtagtctcttgc gtcgctgatttggcattcaagtttacagaggggctggccaaggatcttcagatatttgca cagcatgcgaatcgtaaatgtgtgaacatggaagatgtcatactttctgctcaccgaaat gaacatatctctagctatttgaggaccttctccaatgatttaaaggccaacgcatctgaa aggaaaagaacgaaagagaccaagaagaatgacaaaacacccatctaa

DBGET integrated database retrieval system