Arachis hypogaea (peanut): 112783501
Help
Entry
112783501 CDS
T07294
Name
(RefSeq) mitochondrial import inner membrane translocase subunit TIM17-1-like
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
ahf
Arachis hypogaea (peanut)
Brite
KEGG Orthology (KO) [BR:
ahf00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
ahf03029
]
112783501
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ahf02000
]
112783501
Mitochondrial biogenesis [BR:
ahf03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
112783501
Transporters [BR:
ahf02000
]
Other transporters
Primary active transporters [TC:
3
]
112783501
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
112783501
NCBI-ProteinID:
XP_025682257
LinkDB
All DBs
Position
20:1947414..1948822
Genome browser
AA seq
138 aa
AA seq
DB search
MASMFRELHETDDLGLNMRAPVNLDQFGFNHLSTFYFFKSLRISPTHIPTACHAVRLNAP
RVGGKFAAWNALCYASHYALVSVRQKDDGWNSIFSTAIGTGLLSVCRRSLRASARFTMGG
ALLGAVAQVSSIMLDMHV
NT seq
417 nt
NT seq
+upstream
nt +downstream
nt
atggcgtcaatgtttcgagaattacatgaaacagatgatttgggtttgaacatgagggct
cccgttaatttggatcaatttggatttaaccatttatccaccttctacttcttcaagtcc
cttcgcatctctccaacccatatccctacggcttgccacgccgtccgcctcaatgcaccc
cgcgtcgggggcaaatttgccgcctggaatgccctctgctatgcctcccactacgccttg
gtttctgttcgtcagaaggacgacggctggaacagcatattttccacggccatcggcacc
gggctgctctccgtgtgccgccgcagtctcagagcctccgcacgcttcaccatgggtggt
gctctcctcggcgcagtagcacaggtcagctcaatcatgcttgacatgcatgtttga
DBGET
integrated database retrieval system