Arachis hypogaea (peanut): 112795574 Help Entry 112795574         CDS       T07294                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism ahf  Arachis hypogaea (peanut) Pathway ahf03083   Polycomb repressive complex ahf04120   Ubiquitin mediated proteolysis ahf04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ahf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112795574    04120 Ubiquitin mediated proteolysis     112795574   09126 Chromosome    03083 Polycomb repressive complex     112795574  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ahf04131]     112795574    04121 Ubiquitin system [BR:ahf04121]     112795574    03036 Chromosome and associated proteins [BR:ahf03036]     112795574 Membrane trafficking [BR:ahf04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     112795574 Ubiquitin system [BR:ahf04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      112795574    Cul7 complex      112795574 Chromosome and associated proteins [BR:ahf03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      112795574   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      112795574 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Methyltransf_16 Motif Other DBs NCBI-GeneID:  112795574 NCBI-ProteinID:  XP_025693365 LinkDB All DBs Position 1:9752279..9752962 Genome browser AA seq 155 aa AA seqDB search MSSTRKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVEAANAEERPNEEDLKTWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgacgagaaagatcaccctcaagagctcggacggagaggcgttcgaggtggac gaggcggtggcgctggaatcgcagacgatcaagcacatgatcgaggacgattgtgccgat agcggcatccctctccccaacgtcaccagcaagatccttgcgaaggtcatcgagtactgc aagaagcacgtcgaggctgcgaacgccgaagagaggcctaacgaggaagacctcaagacc tgggacgcagatttcgtcaaggttgaccaggccaccctcttcgatctcatcctggctgcg aactacttgaacatcaagagcctgctggatctcacatgccaaactgtggcagacatgatc aaggggaagactcctgaggaaattcgtaagacattcaacatcaagaatgatttcactccg gaggaagaggaggaagttcgtcgggaaaaccaatgggcatttgaatga

DBGET integrated database retrieval system