Arachis hypogaea (peanut): 112800551 Help Entry 112800551         CDS       T07294                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism ahf  Arachis hypogaea (peanut) Pathway ahf03083   Polycomb repressive complex ahf04120   Ubiquitin mediated proteolysis ahf04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ahf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112800551    04120 Ubiquitin mediated proteolysis     112800551   09126 Chromosome    03083 Polycomb repressive complex     112800551  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ahf04131]     112800551    04121 Ubiquitin system [BR:ahf04121]     112800551    03036 Chromosome and associated proteins [BR:ahf03036]     112800551 Membrane trafficking [BR:ahf04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     112800551 Ubiquitin system [BR:ahf04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      112800551    Cul7 complex      112800551 Chromosome and associated proteins [BR:ahf03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      112800551   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      112800551 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  112800551 NCBI-ProteinID:  XP_025698662 LinkDB All DBs Position 5:7740369..7741418 Genome browser AA seq 146 aa AA seqDB search MASTKKIILKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVDAAASEEKPSEEDLKMWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPRKPVGV NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaacgaagaagatcattttgaaaagttccgatggcgaggcgtttgaggttgac gaggcagtggctctcgaatcgcagacgatcaagcacatgatcgaagacgattgcgctgac agtggaattcctcttccaaacgtcaccagcaagatccttgcgaaggtgattgagtattgc aagaagcacgtcgatgctgctgcttccgaggagaagccgtctgaggaggatctcaagatg tgggatgctgaattcgttaaggtcgatcaggccacgctcttcgatctcattctggctgca aactacttgaacatcaagagcctcttggaccttacttgccagacagtggcagacatgatc aagggcaagactccggaggagattcgcaagacgttcaatatcaagaacgacttcacgccg cgaaaaccagtgggcgtttga

DBGET integrated database retrieval system