Arachis hypogaea (peanut): 140172840 Help Entry 140172840         CDS       T07294                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism ahf  Arachis hypogaea (peanut) Pathway ahf03083   Polycomb repressive complex ahf04120   Ubiquitin mediated proteolysis ahf04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ahf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     140172840    04120 Ubiquitin mediated proteolysis     140172840   09126 Chromosome    03083 Polycomb repressive complex     140172840  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ahf04131]     140172840    04121 Ubiquitin system [BR:ahf04121]     140172840    03036 Chromosome and associated proteins [BR:ahf03036]     140172840 Membrane trafficking [BR:ahf04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     140172840 Ubiquitin system [BR:ahf04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      140172840    Cul7 complex      140172840 Chromosome and associated proteins [BR:ahf03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      140172840   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      140172840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB DarP DUF4983 Motif Other DBs NCBI-GeneID:  140172840 NCBI-ProteinID:  XP_025689881 LinkDB All DBs Position 1:complement(4227928..4230815) Genome browser AA seq 156 aa AA seqDB search MGSPPKKIMLCSSEKEIFNVEEQVMVQHSVIINNMIKDGSFNHEESKIPLDCVDSKTLKK IIEYCTHHTHHHNDNQKDLEAWDAQFLNVDPNTLYDLLMAANYLEIRNLLDLIYGTIKNM IKGKKIDEIRRIFNIKDHGFTPEEEEQNRKEYPHLY NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgggttcgccgccgaagaagatcatgctatgcagttcggaaaaggagattttcaatgtg gaagaacaagtgatggtgcaacattcggtgatcataaacaacatgatcaaagatgggtcg tttaaccatgaagagagcaagattccactggattgcgttgactccaagaccctcaagaag atcatcgagtattgtacgcaccacactcaccaccacaacgacaaccaaaaagatcttgag gcttgggatgctcaatttctcaatgttgatcctaacaccctttatgatttgttgatggca gcaaattatcttgagattagaaatctcttggatctgatatacggaactataaaaaatatg ataaagggaaagaaaatagatgagatacgcagaatcttcaacatcaaagaccatggcttc actcctgaagaggaagaacaaaatcgcaaggagtacccacatctttattag

DBGET integrated database retrieval system