Arachis hypogaea (peanut): 36489160 Help Entry 36489160          CDS       T07294                                  Symbol atpH, DDI71_pgp062 Name (RefSeq) ATP synthase CF0 subunit III   KO K02110   F-type H+-transporting ATPase subunit c Organism ahf  Arachis hypogaea (peanut) Pathway ahf00190   Oxidative phosphorylation ahf00195   Photosynthesis ahf01100   Metabolic pathways Module ahf_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ahf00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     36489160 (atpH)    00195 Photosynthesis     36489160 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ahf00194]     36489160 (atpH) Photosynthesis proteins [BR:ahf00194]  Photosystem and electron transport system   F-type ATPase [OT]    36489160 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  36489160 NCBI-ProteinID:  YP_009472160 UniProt:  A0A191UJ71 LinkDB All DBs Position Pltd:49254..49499 Genome browser AA seq 81 aa AA seqDB search MNPLIAAASVVAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgattgctgctgcttccgttgttgctgctgggttggctgtagggcttgct tctattggacctggggttggccaaggcactgctgcagggcaagcagtagaagggattgcg cgacaaccagaggcagagggaaaaatacggggtactttattgcttagtctagcgtttatg gaagcgttaacaatttatgggctggttgtagcattagcacttttatttgcgaatcccttt gtttaa

DBGET integrated database retrieval system