Actinoalloteichus hoggarensis: AHOG_13160
Help
Entry
AHOG_13160 CDS
T04975
Symbol
ykfA
Name
(GenBank) putative murein peptide carboxypeptidase
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
ahg
Actinoalloteichus hoggarensis
Brite
KEGG Orthology (KO) [BR:
ahg00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
ahg01002
]
AHOG_13160 (ykfA)
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
ahg01011
]
AHOG_13160 (ykfA)
Enzymes [BR:
ahg01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
AHOG_13160 (ykfA)
Peptidases and inhibitors [BR:
ahg01002
]
Serine peptidases
Family S66
AHOG_13160 (ykfA)
Peptidoglycan biosynthesis and degradation proteins [BR:
ahg01011
]
Precursor biosynthesis
Carboxypeptidase
AHOG_13160 (ykfA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66
Peptidase_S66C
Motif
Other DBs
NCBI-ProteinID:
ASO20275
UniProt:
A0A221W3A7
LinkDB
All DBs
Position
complement(3008416..3009342)
Genome browser
AA seq
308 aa
AA seq
DB search
MTGARRPGRLVPGDRVAIVAPAGPVTATMLEAGVSILTGWGLDVVIGDHVLDRHPDFPYL
AGRDEDRAADLAKAWSDPDIAGVLCARGGYGCTRTLQRLDLAALAELPPKVFAGSSDVTA
LHQAFGSRLDLVTLFSPMVGSAPFVEHPGAVETLRRTLLEPETTLVLGRPGAGPLVSGRA
RGVSWGGNLSLLAADLGTVDAYPPPPGSIVLLEDVGEDLYRLDRMLTQLDRAGWWANVAG
VALGSWTDCGPLEAVRTLLLDRLGGLGVPIGWELGFGHCDDQLTVPLGVPVELDADAGTL
RLDEPALD
NT seq
927 nt
NT seq
+upstream
nt +downstream
nt
atgacgggcgctcgacgacccgggcggctcgtcccgggcgaccgggtcgcgatcgtcgcg
cccgcgggtccggtcaccgccacgatgctcgaggcgggcgtgtcgatcttgacgggctgg
gggctggacgtcgtgatcggcgaccacgtcctggaccggcatcccgacttcccctatctg
gcgggtcgggacgaggaccgtgccgcggacctcgcgaaggcctggtcggaccccgacatc
gcgggcgtgctctgcgcgcgaggcgggtacggctgcaccaggacgcttcagcggctcgac
ctggccgcgctcgccgagctgccgccgaaggtgttcgcgggatccagcgacgtgacggcc
ctgcatcaggccttcggcagtcggctggatctggtgacgctgttctcgcccatggtgggc
agcgcgcccttcgtcgagcatcccggcgccgtggagaccctgcggcgcacgctgctggag
cccgagaccaccctcgtactggggcggcccggcgcgggcccgctggtgtccggtcgggca
cggggggtcagctggggcggaaacctcagcctgctggccgcggatctcggcaccgtcgac
gcctatccgccgccaccgggatcgatcgtgctgctagaggacgtcggcgaggacctgtac
cgcctggaccggatgctcacccagctcgaccgggcgggctggtgggcgaacgtggccggt
gtggcgctgggatcgtggaccgactgcggcccgctggaggcggtccggacgctgctgctc
gaccggctgggcgggctgggcgtgccgatcggctgggagctcggcttcggccactgtgat
gatcaactcaccgttccgctgggcgtgccggtcgagctggacgccgatgcgggcacgctg
cggctcgacgagcccgccctggactga
DBGET
integrated database retrieval system