Aeromonas hydrophila AL06-06: RY45_10255 Help Entry RY45_10255        CDS       T03748                                  Name (GenBank) damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism ahh  Aeromonas hydrophila AL06-06 Brite KEGG Orthology (KO) [BR:ahh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ahh03400]     RY45_10255 DNA repair and recombination proteins [BR:ahh03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     RY45_10255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  AJQ54440 UniProt:  A0A0F6KC59 LinkDB All DBs Position 2204337..2204585 Genome browser AA seq 82 aa AA seqDB search MRLEIIIDKKHQVPTSTMEALRQELLKQLGEKFPDLHVRVAPGSAMALTVSRASKEDKEL AEAMVQEVWENADSWMPESVAS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgtctggaaatcatcatcgacaaaaaacatcaggtgcccacctcgaccatggaggcg ctgcgtcaggagctgctcaagcaactgggcgagaagttccccgacctgcatgtgcgggtc gcccccggcagcgctatggcgctgacggtcagccgcgccagcaaggaggacaaggagctg gcagaagccatggtgcaggaggtgtgggagaatgccgacagctggatgccggagagtgtt gcctcctga

DBGET integrated database retrieval system