Aeromonas hydrophila AL06-06: RY45_18665 Help Entry RY45_18665        CDS       T03748                                  Name (GenBank) membrane protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ahh  Aeromonas hydrophila AL06-06 Pathway ahh00190   Oxidative phosphorylation ahh01100   Metabolic pathways ahh02020   Two-component system Module ahh_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ahh00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RY45_18665  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     RY45_18665 Enzymes [BR:ahh01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      RY45_18665 SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AJQ55999 LinkDB All DBs Position complement(4142892..4143008) Genome browser AA seq 38 aa AA seqDB search MWYFTWILGLLLACAFGIINALWLEHTENMDRQIDENK NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacctggatcctgggtctgttgctggcttgcgcattcggcatcatcaat gcgctctggctggagcacaccgagaacatggatcgccagatcgatgagaacaagtga

DBGET integrated database retrieval system