Aeromonas hydrophila AH10: VU14_04680 Help Entry VU14_04680        CDS       T03886                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ahi  Aeromonas hydrophila AH10 Pathway ahi01100   Metabolic pathways ahi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VU14_04680    00074 Mycolic acid biosynthesis     VU14_04680   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VU14_04680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKA16197 UniProt:  A0A1B8Z847 LinkDB All DBs Position 996958..997224 Genome browser AA seq 88 aa AA seqDB search MQDLHLEIKQLIIDSLNLEGLTPDDIDSQAPLFGDGLGLDSIDALELGLAIKGRYGIVLS AEDENTRRHFASVTALVALVQAQSKGEA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcaagacctgcatctagagataaaacaactcatcatcgacagcctcaacctcgagggg ctcacccctgacgacatcgacagtcaggcgccgctgttcggtgacggcctggggctggac tccatcgatgcgctggagctgggccttgccatcaagggtcgctacggcatcgtgctctcc gccgaggatgaaaacacccgtcgtcatttcgcctccgtcacggcgctggtcgctctggtg caggcccagtcgaaaggggaggcctga

DBGET integrated database retrieval system