Aeromonas hydrophila AH10: VU14_04685 Help Entry VU14_04685        CDS       T03886                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ahi  Aeromonas hydrophila AH10 Pathway ahi01100   Metabolic pathways ahi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VU14_04685    00074 Mycolic acid biosynthesis     VU14_04685   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VU14_04685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKA16198 LinkDB All DBs Position 997228..997476 Genome browser AA seq 82 aa AA seqDB search MTRDDIFAQIKAALVELFEVDEEAITPEARLYQDLELDSIDAIDLVVYLQKLTGKKIKPE EFKSVRSVNDVVDAVERLLADA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacccgtgacgacatctttgcccagatcaaggccgccctcgtcgagctgttcgaggtc gacgaagaggccatcacccccgaggcccgtctttatcaggatctcgagctcgacagcatc gacgccatcgatctggtggtgtacctgcagaagctgaccggcaagaagatcaagccggaa gagttcaagtcggtgcgcagcgtcaatgacgtggtggatgcggtcgagcgtctgctggcc gacgcctga

DBGET integrated database retrieval system