Aeromonas hydrophila AH10: VU14_10930 Help Entry VU14_10930        CDS       T03886                                  Name (GenBank) hypothetical protein   KO K02345   DNA polymerase III subunit theta [EC:2.7.7.7] Organism ahi  Aeromonas hydrophila AH10 Pathway ahi03030   DNA replication ahi03430   Mismatch repair ahi03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ahi00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     VU14_10930    03430 Mismatch repair     VU14_10930    03440 Homologous recombination     VU14_10930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ahi03032]     VU14_10930    03400 DNA repair and recombination proteins [BR:ahi03400]     VU14_10930 Enzymes [BR:ahi01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      VU14_10930 DNA replication proteins [BR:ahi03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      VU14_10930 DNA repair and recombination proteins [BR:ahi03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      VU14_10930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_theta DUF3283 Glyco_hydro_123_N_2 Motif Other DBs NCBI-ProteinID:  AKA17346 LinkDB All DBs Position 2438338..2438535 Genome browser AA seq 65 aa AA seqDB search MSFNLCSLPKDEQEKVEVEKAAAYAVWKERNPEIKIPAESEAGNYKGEMQAYFLQRVEQY RKNIR NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgtcattcaatctgtgctccctgccgaaagacgagcaggagaaggtcgaggtagagaag gccgccgcctatgcggtatggaaggaaaggaaccccgagatcaagatcccagccgagagc gaggccgggaactacaagggggagatgcaggcctacttcctgcagcgggtagagcagtat cggaaaaacatacgatga

DBGET integrated database retrieval system