Aeromonas hydrophila AH10: VU14_21515 Help Entry VU14_21515        CDS       T03886                                  Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism ahi  Aeromonas hydrophila AH10 Brite KEGG Orthology (KO) [BR:ahi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ahi03036]     VU14_21515 Chromosome and associated proteins [BR:ahi03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     VU14_21515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA DUF7491 DUF2046 NET2A HR1 TSC22 BicD Nuf2_DHR10-like Uso1_p115_C ADIP TolA_bind_tri DUF7603 CCDC138_cc NUDE_C K-box Mod_r XRCC4_CC DivIC Spectrin GAS DUF6262 Herpes_UL6 DUF244 Cep57_MT_bd Sipho_Gp157 CtIP_N DUF2203 FliT bZIP_1 Spc24 FlaC_arch APG6_N AKNA Spc7 bZIP_2 Prominin Motif Other DBs NCBI-ProteinID:  AKA19317 UniProt:  A0A081UXQ2 LinkDB All DBs Position complement(4782647..4782856) Genome browser AA seq 69 aa AA seqDB search MSLEVLEQLESKVQSAVDNISLLKMELDELKEQNNKLQDENHQLRNEHVAWQERLRALLG KMDQMGESI NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgtcactagaagtccttgagcaactcgaatccaaagtacaatccgccgtcgacaacatc tccctgctgaagatggagctggacgagctgaaagagcagaacaacaagctgcaagacgag aaccatcagctgcgcaacgagcacgtcgcctggcaagaacgtctgcgtgccctgctgggc aagatggaccagatgggcgaaagcatctga

DBGET integrated database retrieval system