Aeromonas hydrophila J-1: V469_11380 Help Entry V469_11380        CDS       T03574                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ahj  Aeromonas hydrophila J-1 Pathway ahj01100   Metabolic pathways ahj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     V469_11380    00074 Mycolic acid biosynthesis     V469_11380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     V469_11380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 EutQ HLH MAP Motif Other DBs NCBI-ProteinID:  AJE36403 LinkDB All DBs Position 2486738..2486974 Genome browser AA seq 78 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEDVKNAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYITANQE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcatcattgaacaactgggtgttaaagaa gaagacgttaagaacgctgcctccttcgtcgacgacctgggcgctgactctttggatacc gttgaactggtaatggcgctggaagaagaattcgataccgaaattcctgatgaagaagcc gagaagatcaccactgttcaagcggctatcgactacatcaccgctaatcaggaataa

DBGET integrated database retrieval system