Aeromonas hydrophila J-1: V469_18740 Help Entry V469_18740        CDS       T03574                                  Symbol groES Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism ahj  Aeromonas hydrophila J-1 Brite KEGG Orthology (KO) [BR:ahj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ahj03110]     V469_18740 (groES)    03029 Mitochondrial biogenesis [BR:ahj03029]     V469_18740 (groES) Chaperones and folding catalysts [BR:ahj03110]  Heat shock proteins   HSP10    V469_18740 (groES) Mitochondrial biogenesis [BR:ahj03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     V469_18740 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Rad9_Rad53_bind Motif Other DBs NCBI-ProteinID:  AJE37773 LinkDB All DBs Position complement(4100428..4100721) Genome browser AA seq 97 aa AA seqDB search MKIRPLHDRVIIKRIEAEAKSAGGIVLTGTAAQKSTRGEVLAVGTGRILDNGDVKALAVK VGDKVIFNEGYGVKTEKLDGQDVLILSETDILAIVEE NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtccactgcacgaccgcgtcatcatcaagcgcatcgaagctgaagccaaa tccgctggcggcattgtcttgactggtactgcggcccagaagtccacccgtggtgaagtt cttgccgtggggactggccgaattctggataatggcgatgtcaaagccctcgccgtcaag gttggtgacaaggtgatcttcaacgaaggctacggtgtgaagaccgagaagctggatggt caggacgtactgatcctgtctgaaaccgacatcctggcgattgtcgaagagtaa

DBGET integrated database retrieval system