Acinetobacter haemolyticus: AHTJS_13895 Help Entry AHTJS_13895       CDS       T04618                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism ahl  Acinetobacter haemolyticus Brite KEGG Orthology (KO) [BR:ahl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ahl03110]     AHTJS_13895 Chaperones and folding catalysts [BR:ahl03110]  Protein folding catalysts   Protein disulfide isomerase    AHTJS_13895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N Glrx-like SSXRD GST_N_3 SH3BGR GST_N_2 Thioredoxin_2 Thioredoxin_4 RBFA Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  APR71335 UniProt:  A0A1L6KQI4 LinkDB All DBs Position 2827826..2828086 Genome browser AA seq 86 aa AA seqDB search MTTPNVTIYSTLSCPYCVRAKQLLERKGVAYKEINLSNEAPEVRIELMQRTNHRTVPQIF IKDQFIGGFDQLYALEREGKLDSLLA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacaactccaaacgtcacgatctattcaacactttcttgtccatattgtgtccgtgcg aaacaattgctggaacgtaagggtgttgcttataaagaaattaatctttccaatgaggcg ccggaagttcgtattgagttaatgcaacgtactaatcatcgtaccgtgccacaaattttt atcaaagaccagtttattggcggtttcgaccaactttatgctttagagcgtgaaggtaaa ctcgattcattattggcttaa

DBGET integrated database retrieval system