Actinoalloteichus hymeniacidonis: TL08_05025 Help Entry TL08_05025        CDS       T04472                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ahm  Actinoalloteichus hymeniacidonis Pathway ahm00998   Biosynthesis of various antibiotics ahm01100   Metabolic pathways ahm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TL08_05025    00074 Mycolic acid biosynthesis     TL08_05025   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TL08_05025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  AOS61833 UniProt:  A0AAC9HMG6 LinkDB All DBs Position 1059883..1060152 Genome browser AA seq 89 aa AA seqDB search MNDIERAIGSMLAADLFVEVPEDRMNPDDRLRGDLGLDSLGFVELRVQCENTFGVTISDA DFTPENFTSIGTVAGLVRSLQSKTSVAGD NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgaacgacatcgagcgagccatcggctccatgctggccgccgacctgttcgtcgaggtc ccggaggaccggatgaaccccgatgaccggttgcgtggcgatctcggactggactccctg ggcttcgtcgagttgcgcgtccagtgcgagaacaccttcggcgtcaccatctccgacgcc gatttcaccccggagaacttcaccagcatcggcaccgtcgccggtctcgtccgctccctg cagagcaagacgtcggtcgcgggcgactga

DBGET integrated database retrieval system