Actinoalloteichus hymeniacidonis: TL08_10475 Help Entry TL08_10475        CDS       T04472                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism ahm  Actinoalloteichus hymeniacidonis Pathway ahm00253   Tetracycline biosynthesis ahm01056   Biosynthesis of type II polyketide backbone ahm01100   Metabolic pathways ahm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahm00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     TL08_10475    00253 Tetracycline biosynthesis     TL08_10475  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:ahm01004]     TL08_10475    01008 Polyketide biosynthesis proteins [BR:ahm01008]     TL08_10475 Lipid biosynthesis proteins [BR:ahm01004]  Polyketide synthase   Component type    TL08_10475 Polyketide biosynthesis proteins [BR:ahm01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      TL08_10475     Nonaketide PKS      TL08_10475     Decaketide PKS      TL08_10475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AOS62909 UniProt:  A0AAC9MY02 LinkDB All DBs Position 2252230..2252490 Genome browser AA seq 86 aa AA seqDB search MSIFTLDELREIMRSSAGVDEGVDLDSDIGDRDFDDLGYDSLAVLEFASIVQRRYGVPIP DDIVTESGTPAKAVHFINIQLEKAGA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgagcatcttcaccttggacgagctgcgggagatcatgcgatccagcgccggtgtcgac gagggcgtcgatctggattccgacatcggcgaccgcgacttcgacgacttgggctacgac tccctggccgtcctggaattcgccagcatcgtgcagcgccgctacggcgtgcccatcccc gacgacatcgtgaccgagtcgggcacccccgcgaaagcggtccacttcatcaacatccag ctcgagaaggcaggagcctga

DBGET integrated database retrieval system