Atlantibacter hermannii: NCTC12129_00295 Help Entry NCTC12129_00295   CDS       T05790                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism ahn  Atlantibacter hermannii Pathway ahn01100   Metabolic pathways ahn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC12129_00295    00074 Mycolic acid biosynthesis     NCTC12129_00295   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC12129_00295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  VDZ71243 LinkDB All DBs Position 1:complement(281627..281884) Genome browser AA seq 85 aa AA seqDB search MQALYAEIKNLIITTLNLDELTADDIDAEAPLFGDGLGLDSIDALELGLAVKTQYGVVLS AESEEMRQHFYSVATLAAFINSQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctacgctgaaattaaaaatctgattatcaccaccctgaatctcgacgaa ctgaccgccgatgatattgacgcagaagcgccgctgtttggcgacggcctgggcctggat tccatcgacgcgctggagttggggctggcagtgaaaacccagtatggcgtagtgctctcc gccgaaagcgaagaaatgcgccagcatttttattccgtcgccacgctggctgcattcatt aattctcaacgcgcctga

DBGET integrated database retrieval system