Atlantibacter hermannii: NCTC12129_01580 Help Entry NCTC12129_01580   CDS       T05790                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ahn  Atlantibacter hermannii Pathway ahn01100   Metabolic pathways ahn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC12129_01580   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC12129_01580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  VDZ72486 UniProt:  A0A447LL76 LinkDB All DBs Position 1:1459696..1459953 Genome browser AA seq 85 aa AA seqDB search MNIETIYHALSDMLCDAKDISPDVLSGATPLNQLELDSLDYVEMTVLVKRNFGVTLTGEV FATNPNMTLNELCEFILTKSQEVPA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaatattgaaacgatttaccacgcattaagtgacatgttgtgtgacgccaaagacatc agccctgatgtcctgagcggggcaaccccgcttaaccagttggagctggatagccttgat tatgtagaaatgacggtgctggtaaaacgcaactttggcgtaacgctaacaggcgaagtg tttgccacaaacccgaatatgacgctgaatgagttatgtgaattcattctgacgaaaagt caggaagttccggcatga

DBGET integrated database retrieval system