Aeromonas hydrophila pc104A: V429_04575 Help Entry V429_04575        CDS       T03193                                  Symbol groES Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism ahp  Aeromonas hydrophila pc104A Brite KEGG Orthology (KO) [BR:ahp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ahp03110]     V429_04575 (groES)    03029 Mitochondrial biogenesis [BR:ahp03029]     V429_04575 (groES) Chaperones and folding catalysts [BR:ahp03110]  Heat shock proteins   HSP10    V429_04575 (groES) Mitochondrial biogenesis [BR:ahp03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     V429_04575 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Rad9_Rad53_bind Motif Other DBs NCBI-ProteinID:  AHX68176 LinkDB All DBs Position 964627..964920 Genome browser AA seq 97 aa AA seqDB search MKIRPLHDRVIIKRIEAEAKSAGGIVLTGTAAQKSTRGEVLAVGTGRILDNGDVKALAVK VGDKVIFNEGYGVKTEKLDGQDVLILSETDILAIVEE NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtccactgcacgaccgcgtcatcatcaagcgcatcgaagctgaagccaaa tccgctggcggcattgtcttgactggtactgcggcccagaagtccacccgtggtgaagtt cttgccgtggggactggccgaattctggataatggcgatgtcaaagccctcgccgtcaag gttggtgacaaggtgatcttcaacgaaggctacggtgtgaagaccgagaagctggatggt caggacgtactgatcctgtctgaaaccgacatcctggcgattgtcgaagagtaa

DBGET integrated database retrieval system