Aeromonas hydrophila pc104A: V429_10635 Help Entry V429_10635        CDS       T03193                                  Name (GenBank) damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism ahp  Aeromonas hydrophila pc104A Brite KEGG Orthology (KO) [BR:ahp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ahp03400]     V429_10635 DNA repair and recombination proteins [BR:ahp03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     V429_10635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  AHX69328 LinkDB All DBs Position 2267943..2268191 Genome browser AA seq 82 aa AA seqDB search MRLEIIIDKKHQVPTSTMEALRQELLKQLGEKFPDLHVRVAPGSAMALTVSRASKEDKEL AEAMVQEVWENADSWMPESVAS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgtctggaaatcatcatcgacaaaaaacatcaggtgcccacctcgaccatggaggcg ctgcgtcaggagctgctcaagcaactgggcgaaaagttccccgacctgcatgtgcgggtc gcccccggtagcgccatggcactgacggtcagccgcgccagcaaggaggacaaggagctg gctgaagccatggtgcaggaggtatgggagaatgccgacagttggatgccggagagtgtt gcctcctga

DBGET integrated database retrieval system