Aeromonas hydrophila pc104A: V429_22925 Help Entry V429_22925        CDS       T03193                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism ahp  Aeromonas hydrophila pc104A Pathway ahp00290   Valine, leucine and isoleucine biosynthesis ahp00650   Butanoate metabolism ahp00660   C5-Branched dibasic acid metabolism ahp00770   Pantothenate and CoA biosynthesis ahp01100   Metabolic pathways ahp01110   Biosynthesis of secondary metabolites ahp01210   2-Oxocarboxylic acid metabolism ahp01230   Biosynthesis of amino acids Module ahp_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine ahp_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:ahp00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     V429_22925    00660 C5-Branched dibasic acid metabolism     V429_22925   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     V429_22925   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     V429_22925 Enzymes [BR:ahp01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      V429_22925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss ACT_4 AlkA_N HeLo Motif Other DBs NCBI-ProteinID:  AHX71549 LinkDB All DBs Position complement(4934705..4934956) Genome browser AA seq 83 aa AA seqDB search MSQFNTLQIHAQPRPEVMERVLRVVRHRGFNLCALNMEQDCQQLRITVTVESVRPIQQLW SQLVKLVDVSRVDALEQQPRIRA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagtcagttcaataccttgcaaatccatgcccagcccagacccgaagtgatggagcgg gtgctgcgggtggttcgtcaccgcggtttcaacctctgcgccctcaacatggagcaggat tgccaacagctgcggatcacggttactgtcgagtcggtgcgtcccatccagcagttgtgg agccagctggtgaagctggtggacgtttcccgggtcgatgcactggaacagcaaccccgg atcagagcttaa

DBGET integrated database retrieval system