Allocoprobacillus halotolerans: NMU03_15190 Help Entry NMU03_15190       CDS       T09839                                  Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism ahq  Allocoprobacillus halotolerans Brite KEGG Orthology (KO) [BR:ahq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ahq03110]     NMU03_15190    03029 Mitochondrial biogenesis [BR:ahq03029]     NMU03_15190 Chaperones and folding catalysts [BR:ahq03110]  Heat shock proteins   HSP10    NMU03_15190 Mitochondrial biogenesis [BR:ahq03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     NMU03_15190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  UTY40882 LinkDB All DBs Position 2593605..2593793 Genome browser AA seq 62 aa AA seqDB search MLTSPKEQASNQATVVSVGPKCDDHLKAGMTVIFKEYSGTKFKDNDDEYMILEEEDILAI VE NT seq 189 nt NT seq  +upstreamnt  +downstreamnt attttaacgagtccaaaggaacaagccagtaatcaagcaactgttgtatctgttggacct aaatgtgatgatcatttaaaagcaggcatgacagttatttttaaagaatactctggaaca aaatttaaagataatgatgatgaatatatgatcttagaagaagaagatattttagctatt gttgaatag

DBGET integrated database retrieval system