Malaciobacter halophilus: AHALO_0329 Help Entry AHALO_0329        CDS       T05822                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ahs  Malaciobacter halophilus Pathway ahs01100   Metabolic pathways ahs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AHALO_0329 (acpP)    00074 Mycolic acid biosynthesis     AHALO_0329 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AHALO_0329 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AXH08730 UniProt:  A0A2N1J3Y5 LinkDB All DBs Position complement(326639..326869) Genome browser AA seq 76 aa AA seqDB search MALLDDVKEVVVEQLDCDIAEIKEDSKFIEDLGADSLDVVELVMALEEKFDIEIPDEDAE GIQTVADAIKYIEEHA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattattagatgatgtaaaagaagtagtagtagagcaacttgattgtgatattgca gagatcaaagaagattctaaatttatcgaggatttaggagcagactctttagacgtagtt gaattagttatggctttagaagagaagtttgatatcgaaatccctgatgaagatgcagaa ggtatccaaactgttgctgatgctattaaatacatcgaagagcacgcgtaa

DBGET integrated database retrieval system