Azospirillum humicireducens: A6A40_07115 Help Entry A6A40_07115       CDS       T04409                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ahu  Azospirillum humicireducens Pathway ahu01100   Metabolic pathways ahu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A6A40_07115    00074 Mycolic acid biosynthesis     A6A40_07115   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A6A40_07115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 DUF5783 Motif Other DBs NCBI-ProteinID:  ANC91695 UniProt:  A0A160JFM0 LinkDB All DBs Position complement(1556813..1557052) Genome browser AA seq 79 aa AA seqDB search MSDIAERVKKIVVDHLGVEESKVVENASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA EKILSVKDAIDFIKANAAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgccgagcgcgtgaagaagatcgttgtggaccacctgggtgtcgaggag tcgaaggtggtggagaacgcctccttcatcgacgatctgggcgccgacagcctcgacacc gtcgagctggttatggccttcgaggaagagttcggtgtcgagatcccggacgacgccgcg gagaagatcctgtcggtgaaggacgccatcgacttcatcaaggccaacgccgccgcctga

DBGET integrated database retrieval system