Aeromonas hydrophila ML09-119: AHML_04380 Help Entry AHML_04380        CDS       T02683                                  Symbol groES Name (GenBank) co-chaperonin GroES   KO K04078   chaperonin GroES Organism ahy  Aeromonas hydrophila ML09-119 Brite KEGG Orthology (KO) [BR:ahy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ahy03110]     AHML_04380 (groES)    03029 Mitochondrial biogenesis [BR:ahy03029]     AHML_04380 (groES) Chaperones and folding catalysts [BR:ahy03110]  Heat shock proteins   HSP10    AHML_04380 (groES) Mitochondrial biogenesis [BR:ahy03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     AHML_04380 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Rad9_Rad53_bind Motif Other DBs NCBI-ProteinID:  AGM42660 LinkDB All DBs Position 964941..965234 Genome browser AA seq 97 aa AA seqDB search MKIRPLHDRVIIKRIEAEAKSAGGIVLTGTAAQKSTRGEVLAVGTGRILDNGDVKALAVK VGDKVIFNEGYGVKTEKLDGQDVLILSETDILAIVEE NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtccactgcacgaccgcgtcatcatcaagcgcatcgaagctgaagccaaa tccgctggcggcattgtcttgactggtactgcggcccagaagtccacccgtggtgaagtt cttgccgtggggactggccgaattctggataatggcgatgtcaaagccctcgccgtcaag gttggtgacaaggtgatcttcaacgaaggctacggtgtgaagaccgagaagctggatggt caggacgtactgatcctgtctgaaaccgacatcctggcgattgtcgaagagtaa

DBGET integrated database retrieval system