Aeromonas hydrophila ML09-119: AHML_11675 Help Entry AHML_11675        CDS       T02683                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ahy  Aeromonas hydrophila ML09-119 Pathway ahy01100   Metabolic pathways ahy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AHML_11675 (acpP)    00074 Mycolic acid biosynthesis     AHML_11675 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AHML_11675 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 EutQ HLH MAP Motif Other DBs NCBI-ProteinID:  AGM44117 LinkDB All DBs Position complement(2593588..2593824) Genome browser AA seq 78 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEDVKNAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYITANQE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcatcattgaacaactgggtgttaaagaa gaagacgttaagaacgctgcctccttcgtcgacgacctgggcgctgactctttggatacc gttgaactggtaatggcgctggaagaagaattcgataccgaaattcctgatgaagaagcc gagaagatcaccactgttcaagcggctatcgactacatcaccgctaatcaggaataa

DBGET integrated database retrieval system