Aeromonas hydrophila ML09-119: AHML_19190 Help Entry AHML_19190        CDS       T02683                                  Name (GenBank) Cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ahy  Aeromonas hydrophila ML09-119 Pathway ahy00190   Oxidative phosphorylation ahy01100   Metabolic pathways ahy02020   Two-component system Module ahy_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ahy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AHML_19190  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AHML_19190 Enzymes [BR:ahy01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      AHML_19190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AGM45603 LinkDB All DBs Position complement(4349583..4349699) Genome browser AA seq 38 aa AA seqDB search MWYFTWILGLLLACAFGIINALWLEHTENMDRQIDENK NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacctggatcctgggtctgttgctggcttgcgcattcggcatcatcaat gcgctctggctggagcacaccgagaacatggatcgccagatcgatgagaacaagtga

DBGET integrated database retrieval system