Anomalospiza imberbis (cuckoo-finch): 137462639 Help Entry 137462639         CDS       T11605                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism aib  Anomalospiza imberbis (cuckoo-finch) Pathway aib04010   MAPK signaling pathway aib04012   ErbB signaling pathway aib04068   FoxO signaling pathway aib04137   Mitophagy - animal aib04140   Autophagy - animal aib04150   mTOR signaling pathway aib04210   Apoptosis aib04218   Cellular senescence aib04370   VEGF signaling pathway aib04371   Apelin signaling pathway aib04540   Gap junction aib04625   C-type lectin receptor signaling pathway aib04810   Regulation of actin cytoskeleton aib04910   Insulin signaling pathway aib04912   GnRH signaling pathway aib04916   Melanogenesis Brite KEGG Orthology (KO) [BR:aib00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     137462639 (NRAS)    04012 ErbB signaling pathway     137462639 (NRAS)    04370 VEGF signaling pathway     137462639 (NRAS)    04371 Apelin signaling pathway     137462639 (NRAS)    04068 FoxO signaling pathway     137462639 (NRAS)    04150 mTOR signaling pathway     137462639 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     137462639 (NRAS)    04137 Mitophagy - animal     137462639 (NRAS)   09143 Cell growth and death    04210 Apoptosis     137462639 (NRAS)    04218 Cellular senescence     137462639 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     137462639 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     137462639 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     137462639 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     137462639 (NRAS)    04912 GnRH signaling pathway     137462639 (NRAS)    04916 Melanogenesis     137462639 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aib04131]     137462639 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aib04147]     137462639 (NRAS)    04031 GTP-binding proteins [BR:aib04031]     137462639 (NRAS) Membrane trafficking [BR:aib04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     137462639 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     137462639 (NRAS) Exosome [BR:aib04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    137462639 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    137462639 (NRAS)   Exosomal proteins of breast cancer cells    137462639 (NRAS)   Exosomal proteins of colorectal cancer cells    137462639 (NRAS) GTP-binding proteins [BR:aib04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     137462639 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  137462639 NCBI-ProteinID:  XP_068029305 LinkDB All DBs Position 26:complement(4196864..4203066) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtcgtggtgggcgccggcggcgtgggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcgtac cgcaagcaggtggtgatcgatggcgagacgtgcctgctggacatcctggacacggcgggg caggaggagtacagcgccatgagggaccagtacatgaggacaggcgagggcttcctctgc gtcttcgccatcaacaacagcaaatccttcgccgacatcaacctctacagagaacagatc aagagagtgaaggactcggatgacgtgcccatggtgctggtggggaacaagtgtgatctg cccacgagaacagtggacacaaaacaggcccaagaactggcaaaaagctacggaatcccc ttcatagagacctctgcaaaaacgagacagggtgtggaagatgctttttacaccctggtg agggagatccggcagtaccggatgaagaagctcaacagcagcgaggatgggaaccagggc tgcatgggactgtcctgccttgtcatgtga

DBGET integrated database retrieval system