Anomalospiza imberbis (cuckoo-finch): 137470903 Help Entry 137470903         CDS       T11605                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism aib  Anomalospiza imberbis (cuckoo-finch) Pathway aib04145   Phagocytosis aib04814   Motor proteins aib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aib00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     137470903 (DYNLT1)   09142 Cell motility    04814 Motor proteins     137470903 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     137470903 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:aib03037]     137470903 (DYNLT1)    04812 Cytoskeleton proteins [BR:aib04812]     137470903 (DYNLT1) Cilium and associated proteins [BR:aib03037]  Motile cilia and associated proteins   Dynein arm    137470903 (DYNLT1) Cytoskeleton proteins [BR:aib04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137470903 (DYNLT1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  137470903 NCBI-ProteinID:  XP_068040811 LinkDB All DBs Position 3:complement(61736067..61741210) Genome browser AA seq 113 aa AA seqDB search MDEFQTGEEASFLVDEVSSIIKEAIEGAIGGNAYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgagttccagacgggagaggaggcttcctttcttgttgatgaagtcagcagcatc attaaagaggccatagagggtgctatcggtggcaatgcctaccagcacagcaaagtgaac cagtggacaacaagcgtggtggaacaaaccctgagccagctcacaaagctgggcaagccc ttcaagtacatcgtgacctgtgtgattatgcaaaagaatggtgctgggctccatacagca agctcttgcttctgggacaactccagtgatggaacctgcactgtgagatgggagaataag accatgtactgtattgtcagtgcctttggacttgcaatataa

DBGET integrated database retrieval system