Anomalospiza imberbis (cuckoo-finch): 137472782 Help Entry 137472782         CDS       T11605                                  Name (RefSeq) interleukin-8 isoform X1   KO K10030   interleukin 8 Organism aib  Anomalospiza imberbis (cuckoo-finch) Pathway aib04060   Cytokine-cytokine receptor interaction aib04218   Cellular senescence aib04620   Toll-like receptor signaling pathway aib04621   NOD-like receptor signaling pathway aib04622   RIG-I-like receptor signaling pathway aib05132   Salmonella infection aib05164   Influenza A Brite KEGG Orthology (KO) [BR:aib00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     137472782  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     137472782  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     137472782    04621 NOD-like receptor signaling pathway     137472782    04622 RIG-I-like receptor signaling pathway     137472782  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     137472782   09171 Infectious disease: bacterial    05132 Salmonella infection     137472782  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aib04052]     137472782    00536 Glycosaminoglycan binding proteins [BR:aib00536]     137472782 Cytokines and neuropeptides [BR:aib04052]  Cytokines   Chemokines    137472782 Glycosaminoglycan binding proteins [BR:aib00536]  Heparan sulfate / Heparin   Chemokines    137472782 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Ig_J_chain bPH_6 Motif Other DBs NCBI-GeneID:  137472782 NCBI-ProteinID:  XP_068044244 LinkDB All DBs Position 4:43830311..43833703 Genome browser AA seq 103 aa AA seqDB search MNGKLVAILALFLISAAVSQGRTLARMGTELRCQCIATHSRFIPPKSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTAPWVQLIVKAILARAQHNSDSPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaaacttgtagctatcctggctcttttcctgatctcagcagctgtgtctcaa ggtaggaccctggcaaggatgggaaccgagctccgatgccagtgcatagccactcattcc aggtttattcccccaaaatccattcaagatgtgaagctgacacagagtggcccccactgc aagaatgttgaagtcatagctactctgaaggatggcagagaggtgtgcttggagcccact gctccctgggtacagctgattgtaaaggcaattttggccagggctcaacacaattctgac tctcctctctaa

DBGET integrated database retrieval system