KEGG   Aequorivita iocasae: JK629_01840
Entry
JK629_01840       CDS       T07991                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
aic  Aequorivita iocasae
Pathway
aic00770  Pantothenate and CoA biosynthesis
aic01100  Metabolic pathways
aic01240  Biosynthesis of cofactors
Module
aic_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:aic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    JK629_01840 (coaD)
Enzymes [BR:aic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     JK629_01840 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: QQX77043
UniProt: A0ABX7DSR8
LinkDB
Position
384549..384986
AA seq 145 aa
MKRAVFPGTFDPITLGHVDIIKRALPLFDELIIAIGVNADKKTMFSLEERIQFIKNTFGD
NSKIKVKSYTGLTANFCKNEKAQFIVRGLRNSIDFAYEQSIAQANAKVNGVDSIFLICSP
EFSHISSSIVRDIARHGGDYQDLIP
NT seq 438 nt   +upstreamnt  +downstreamnt
atgaagcgcgcagtttttcccggaacttttgaccccataacccttgggcacgtagatatt
ataaaacgtgcgctgccgctttttgatgaattgattattgccattggcgtgaatgccgat
aaaaaaaccatgttttccttggaagagcgaatccaatttataaaaaacacgtttggtgat
aattccaaaattaaagtaaaaagttatacaggacttacggcaaatttctgcaaaaatgaa
aaagcacaatttattgttcgtgggcttcgcaacagtatcgactttgcctatgaacagtct
atcgcacaagccaatgcaaaggttaacggagtagatagtatctttttaatctgcagcccg
gagttttcacatatttcttcttcaattgttagggatatcgcaaggcatgggggtgattat
caagacttaataccctaa

DBGET integrated database retrieval system